PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000288401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 478aa    MW: 53062.1 Da    PI: 7.5349
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000288401genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB159.35.7e-5029123195
          NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                    vreqdr++Pianv+rim+k+lP +akis+daket+qe vse+i+f+t+ea+++cqre+rkt++++d+lwa+++lGf++yvepl++yl++yre e+
  MDP0000288401  29 VREQDRYMPIANVIRIMRKILPPHAKISDDAKETMQESVSEYIAFITGEANERCQREQRKTVTAEDVLWAMGKLGFDNYVEPLTIYLRRYRESES 123
                    59******************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.8E-4825130IPR009072Histone-fold
SuperFamilySSF471136.2E-3632131IPR009072Histone-fold
PfamPF008089.5E-243599IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.3E-146381No hitNo description
PRINTSPR006154.3E-1482100No hitNo description
PRINTSPR006154.3E-14101119No hitNo description
SuperFamilySSF550084.97E-14247318IPR006121Heavy metal-associated domain, HMA
Gene3DG3DSA:3.30.70.1003.4E-17248318No hitNo description
PROSITE profilePS5084618.141252318IPR006121Heavy metal-associated domain, HMA
PfamPF004038.1E-6255314IPR006121Heavy metal-associated domain, HMA
CDDcd003718.83E-11255317No hitNo description
PROSITE patternPS010470257286IPR017969Heavy-metal-associated, conserved site
Gene3DG3DSA:3.40.50.10003.5E-6405440IPR023214HAD-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030001Biological Processmetal ion transport
GO:0046872Molecular Functionmetal ion binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MPSQTPATLP NSAGNSDNNT EQKAPQCLVR EQDRYMPIAN VIRIMRKILP PHAKISDDAK  60
ETMQESVSEY IAFITGEANE RCQREQRKTV TAEDVLWAMG KLGFDNYVEP LTIYLRRYRE  120
SESSDRSQFV TREEPQLMDY CPPGHAGPQV AMMPPPPPSY GPENYFGPQH GPPMYDPSMM  180
GMFRDGSSSG AGGGGSSSAS GAQVYLYVLA WLQSEFSSFE FKDKLVPARK IKEAVEDAGF  240
PVSEFPQQDV AVCXLRIKGM ACTSCSESVE CALRMVDGVK NAVAGLALEE AKVHFDLNLT  300
DTSCIIQGIE DAGFGAELKK VAITYDKDLT GPRSLIRCIE EAGRESKVYQ ASLYVPPRPR  360
EAERKREIQM YRNQFFLRPX RFLYFHSQCN PYGSNGCNRE GCFARCLIKG GNAHQKAHKV  420
KTVAFDTTGT LTVGKPVVVN SVMQCSSPIA QWRSYVLSLL PQRLVPIFQI CTLKASLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-3530120393NF-YB
4awl_B1e-3430120494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-3430120494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-51NF-YB family protein